Lineage for d1b48a2 (1b48 A:2-79)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181196Species Mouse (Mus musculus), class alpha (a1-4) [TaxId:10090] [52873] (2 PDB entries)
  8. 181197Domain d1b48a2: 1b48 A:2-79 [32997]
    Other proteins in same PDB: d1b48a1, d1b48b1

Details for d1b48a2

PDB Entry: 1b48 (more details), 2.6 Å

PDB Description: crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4

SCOP Domain Sequences for d1b48a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b48a2 c.47.1.5 (A:2-79) Glutathione S-transferase {Mouse (Mus musculus), class alpha (a1-4)}
aakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveid
gmmltqtrailsylaaky

SCOP Domain Coordinates for d1b48a2:

Click to download the PDB-style file with coordinates for d1b48a2.
(The format of our PDB-style files is described here.)

Timeline for d1b48a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b48a1