SCOPe 2.07: Domain d5u16e2: 5u16 E:111-198

Lineage for d5u16e2 (5u16 E:111-198)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d5u16e2: 5u16 E:111-198 [329968]
   Other proteins in same PDB: d5u16a1, d5u16a2, d5u16a3, d5u16b_, d5u16c1, d5u16c2, d5u16d_, d5u16e1, d5u16f1, d5u16f2, d5u16g1, d5u16h1, d5u16h2
   automated match to d2f54d2
   complexed with 7wo, cl, gol, na

Details for d5u16e2

PDB Entry: 5u16, 2 Å

PDB Description: structure of human mr1-2-oh-1-na in complex with human mait a-f7 tcr

PDB Compounds: (E:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u16e2:

Sequence, based on SEQRES records:

>d5u16e2 b.1.1.2 (E:111-198) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records):

>d5u16e2 b.1.1.2 (E:111-198) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqsdvyitdkcvldmrsmdfksnsavawsnaca
nafnnsiipedtffp

Timeline for d5u16e2:

• d5u16e2 first appeared in SCOPe 2.06
  
• d5u16e2 appears in the current release, SCOPe 2.08