Lineage for d5wt9g_ (5wt9 G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024260Domain d5wt9g_: 5wt9 G: [329966]
    Other proteins in same PDB: d5wt9l2
    automated match to d3rrqa_
    complexed with fuc, nag

Details for d5wt9g_

PDB Entry: 5wt9 (more details), 2.4 Å

PDB Description: complex structure of pd-1 and nivolumab-fab
PDB Compounds: (G:) Programmed cell death protein 1

SCOPe Domain Sequences for d5wt9g_:

Sequence, based on SEQRES records: (download)

>d5wt9g_ b.1.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldspdrpwnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpe
drsqpgqdcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslrael

Sequence, based on observed residues (ATOM records): (download)

>d5wt9g_ b.1.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldspdrpwnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpe
rfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslrael

SCOPe Domain Coordinates for d5wt9g_:

Click to download the PDB-style file with coordinates for d5wt9g_.
(The format of our PDB-style files is described here.)

Timeline for d5wt9g_: