Lineage for d5kkha_ (5kkh A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225357Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2225358Protein automated matches [226845] (15 species)
    not a true protein
  7. 2225378Species Haloquadratum walsbyi [TaxId:362976] [275383] (5 PDB entries)
  8. 2286664Domain d5kkha_: 5kkh A: [329965]
    automated match to d1cwqa_
    complexed with olb, olc, ret

Details for d5kkha_

PDB Entry: 5kkh (more details), 2.13 Å

PDB Description: 2.1-angstrom in situ mylar structure of bacteriorhodopsin from haloquadratum walsbyi (hwbr) at 100 k
PDB Compounds: (A:) Bacteriorhodopsin-I

SCOPe Domain Sequences for d5kkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kkha_ f.13.1.0 (A:) automated matches {Haloquadratum walsbyi [TaxId: 362976]}
lgvegegiwlalgtigmllgmlyfiadgldvqdprqkefyvitilipaiaaasylsmffg
fgltevslangrvvdvywaryadwlfttplllldigllagasqrdigalvgidafmivtg
lvatltkvvvaryafwtistismvfllyylvavfgeavsdadedtrstfnalrniilvtw
aiypvawlvgteglaltglygetllfmvldlvakvgfgfillrsraim

SCOPe Domain Coordinates for d5kkha_:

Click to download the PDB-style file with coordinates for d5kkha_.
(The format of our PDB-style files is described here.)

Timeline for d5kkha_:

  • d5kkha_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16