SCOPe Funding Alert: SCOPe support from the NIH
ended in April 2016. John-Marc Chandonia is the primary
maintainer and has continued to develop SCOPe using vacation
time. Three proposals to the NIH for continued funding have been
unsuccessful. If our current NIH proposal is not funded,
SCOPe will shut down permanently in Summer 2017
as Dr. Chandonia will need to seek a new position.
Lineage for d5umfc_ (5umf C:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.0: automated matches [191350] (1 protein)
not a true familyProtein automated matches [190292] (34 species)
not a true protein
Species Neisseria gonorrhoeae [TaxId:521006] [329871] (1 PDB entry) 
Domain d5umfc_: 5umf C: [329964]
automated match to d3ovrb_
complexed with gol, po4, zn
Details for d5umfc_
PDB Entry: 5umf (more details), 1.4 Å
PDB Description: crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate
PDB Compounds: (C:) ribulose-phosphate 3-epimeraseSCOPe Domain Sequences for d5umfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5umfc_ c.1.2.0 (C:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
ayriapsilsadfarlgeevanviaagadlihfdvmdnhyvpnltfgpmvcaalkpyasv
pidvhlmvepvddliqsfakagasiitfhpeasrhidrslslirdmgcqaglvlnpatpv
yvlenvldrldmvllmsvnpgfggqsfiphtlekirqvramldryegksgrriaievdgg
iktdniaavaragadtfvagsaifgkpdykaviaamraelekaa
SCOPe Domain Coordinates for d5umfc_:
Click to download the PDB-style file with coordinates for d5umfc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5umfc_:
- d5umfc_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16
View in 3D
