Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [52872] (2 PDB entries) |
Domain d1f3ab2: 1f3a B:1-79 [32996] Other proteins in same PDB: d1f3aa1, d1f3ab1 complexed with gsh |
PDB Entry: 1f3a (more details), 1.9 Å
SCOPe Domain Sequences for d1f3ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3ab2 c.47.1.5 (B:1-79) Class alpha GST {Mouse (Mus musculus), (a1-1) [TaxId: 10090]} agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid gmklaqtrailnyiatkyd
Timeline for d1f3ab2: