![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (20 species) not a true protein |
![]() | Species Scheffersomyces stipitis [TaxId:322104] [328848] (7 PDB entries) |
![]() | Domain d5i5ea1: 5i5e A:2-334 [329958] Other proteins in same PDB: d5i5ea3 automated match to d1ay0a1 complexed with 5sp, ca, tpp; mutant |
PDB Entry: 5i5e (more details), 1.62 Å
SCOPe Domain Sequences for d5i5ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i5ea1 c.36.1.0 (A:2-334) automated matches {Scheffersomyces stipitis [TaxId: 322104]} ssvdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfv lsngcacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgic ngvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliaf wddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptl vrltttigfgslaqgthgvcgaplkaddikqlktkwgfnpeesfavpaevtasynehvae nqkiqqqwnelfaaykqkypelgaelqrrldgk
Timeline for d5i5ea1: