Lineage for d5i5ea1 (5i5e A:2-334)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108851Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2108852Protein automated matches [227126] (20 species)
    not a true protein
  7. 2285547Species Scheffersomyces stipitis [TaxId:322104] [328848] (7 PDB entries)
  8. 2286657Domain d5i5ea1: 5i5e A:2-334 [329958]
    Other proteins in same PDB: d5i5ea3
    automated match to d1ay0a1
    complexed with 5sp, ca, tpp; mutant

Details for d5i5ea1

PDB Entry: 5i5e (more details), 1.62 Å

PDB Description: crystal structure of transketolase mutants-h66/261c complex with xylulose-5-phoaphate from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5i5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i5ea1 c.36.1.0 (A:2-334) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
ssvdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfv
lsngcacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgic
ngvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliaf
wddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptl
vrltttigfgslaqgthgvcgaplkaddikqlktkwgfnpeesfavpaevtasynehvae
nqkiqqqwnelfaaykqkypelgaelqrrldgk

SCOPe Domain Coordinates for d5i5ea1:

Click to download the PDB-style file with coordinates for d5i5ea1.
(The format of our PDB-style files is described here.)

Timeline for d5i5ea1:

  • d5i5ea1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16