Lineage for d5tg3a_ (5tg3 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2286568Species Dioclea reflexa [TaxId:1048258] [329869] (1 PDB entry)
  8. 2286656Domain d5tg3a_: 5tg3 A: [329957]
    automated match to d4nota_
    complexed with ca, mn, xmm

Details for d5tg3a_

PDB Entry: 5tg3 (more details), 1.77 Å

PDB Description: crystal structure of dioclea reflexa seed lectin (drfl) in complex with x-man
PDB Compounds: (A:) Dioclea reflexa lectin

SCOPe Domain Sequences for d5tg3a_:

Sequence, based on SEQRES records: (download)

>d5tg3a_ b.29.1.1 (A:) automated matches {Dioclea reflexa [TaxId: 1048258]}
adtivaveldsypntdigdpnyphigidiksvrskstarwnmqtgkvgtvhisynsvskr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglykqtntilswsftsklktnsi
adenslhfsfhkfsqnpkdlilqgdastdsdgnlqltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdttipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d5tg3a_ b.29.1.1 (A:) automated matches {Dioclea reflexa [TaxId: 1048258]}
adtivaveldsypntdigdpnyphigidiksvrskstarwnmqtgkvgtvhisynsvskr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglykqtntilswsftsklknslh
fsfhkfsqnpkdlilqgdastdsdgnlqltkvsssgdpqgnsvgralfyapvhiweksav
vasfdatftflikspdrepadgitffiantdttipsgsggrllglfpdan

SCOPe Domain Coordinates for d5tg3a_:

Click to download the PDB-style file with coordinates for d5tg3a_.
(The format of our PDB-style files is described here.)

Timeline for d5tg3a_:

  • d5tg3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16