SCOPe 2.06: Domain d5jjfb_: 5jjf B:

Lineage for d5jjfb_ (5jjf B:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.4: Htr2 transmembrane domain-like [158212] (1 family)

5. Family f.17.4.1: Htr2 transmembrane domain-like [158213] (1 protein)

6. Protein Sensory rhodopsin II transducer, Htr2 [158214] (1 species)

7. Species Natronomonas pharaonis [TaxId:2257] [158215] (5 PDB entries)
   Uniprot P42259 27-79! Uniprot P42259 29-79

8. Domain d5jjfb_: 5jjf B: [329956]
   Other proteins in same PDB: d5jjfa_
   automated match to d2f95b1
   complexed with bog, lfa, ret

Details for d5jjfb_

PDB Entry: 5jjf, 1.9 Å

PDB Description: structure of the srii/htrii complex in i212121 space group ("u" shape) - m state

PDB Compounds: (B:) sensory rhodopsin II transducer

SCOPe Domain Sequences for d5jjfb_:

Sequence; same for both SEQRES and ATOM records:

>d5jjfb_ f.17.4.1 (B:) Sensory rhodopsin II transducer, Htr2 {Natronomonas pharaonis [TaxId: 2257]}
mgavfifvgaltvlfgaiaygevtaaaatgdaaavqeaavsailgliillginlglvaat
lgg

Timeline for d5jjfb_:

• d5jjfb_ is new in SCOPe 2.06-stable
  
• d5jjfb_ appears in SCOPe 2.07
  
• d5jjfb_ appears in the current release, SCOPe 2.08