Lineage for d5jjfb_ (5jjf B:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225606Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2225810Superfamily f.17.4: Htr2 transmembrane domain-like [158212] (1 family) (S)
  5. 2225811Family f.17.4.1: Htr2 transmembrane domain-like [158213] (1 protein)
  6. 2225812Protein Sensory rhodopsin II transducer, Htr2 [158214] (1 species)
  7. 2225813Species Natronomonas pharaonis [TaxId:2257] [158215] (5 PDB entries)
    Uniprot P42259 27-79! Uniprot P42259 29-79
  8. 2286655Domain d5jjfb_: 5jjf B: [329956]
    Other proteins in same PDB: d5jjfa_
    automated match to d2f95b1
    complexed with bog, lfa, ret

Details for d5jjfb_

PDB Entry: 5jjf (more details), 1.9 Å

PDB Description: structure of the srii/htrii complex in i212121 space group ("u" shape) - m state
PDB Compounds: (B:) sensory rhodopsin II transducer

SCOPe Domain Sequences for d5jjfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjfb_ f.17.4.1 (B:) Sensory rhodopsin II transducer, Htr2 {Natronomonas pharaonis [TaxId: 2257]}
mgavfifvgaltvlfgaiaygevtaaaatgdaaavqeaavsailgliillginlglvaat
lgg

SCOPe Domain Coordinates for d5jjfb_:

Click to download the PDB-style file with coordinates for d5jjfb_.
(The format of our PDB-style files is described here.)

Timeline for d5jjfb_:

  • d5jjfb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16