Lineage for d5u8pa_ (5u8p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (233 species)
    not a true protein
  7. 2094600Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries)
  8. 2286651Domain d5u8pa_: 5u8p A: [329952]
    automated match to d3r3sa_
    complexed with mg, nad

Details for d5u8pa_

PDB Entry: 5u8p (more details), 1.4 Å

PDB Description: crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nad
PDB Compounds: (A:) Short chain dehydrogenase

SCOPe Domain Sequences for d5u8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u8pa_ c.2.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
gltnpvdlypkppfphqvqappglasrmqprpdhgeqsyrgrgrlvgrktlvtggdsgig
raaaiafaregadvaigylpveesdarevvaliraagrqavalpgdirdetfcqrlvara
aealggldilvnnaarqqaldsigemttehfdatvktnlygmfwitkaaiphlppgasii
nttsvqavrasanlldyattkagiiaftrslakqlgprgirvnavapgpywtplqssggq
ppetvvnyaagspygrpgqpaeiaplyvalaasetsyangqvwgadgglgif

SCOPe Domain Coordinates for d5u8pa_:

Click to download the PDB-style file with coordinates for d5u8pa_.
(The format of our PDB-style files is described here.)

Timeline for d5u8pa_:

  • d5u8pa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16