Lineage for d5um7a_ (5um7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (165 species)
    not a true protein
  7. 2286630Species Streptococcus gordonii [TaxId:467705] [329931] (1 PDB entry)
  8. 2286650Domain d5um7a_: 5um7 A: [329951]
    automated match to d2h1bc_
    complexed with act

Details for d5um7a_

PDB Entry: 5um7 (more details), 1.62 Å

PDB Description: crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii
PDB Compounds: (A:) Thioredoxin signature protein

SCOPe Domain Sequences for d5um7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5um7a_ c.47.1.0 (A:) automated matches {Streptococcus gordonii [TaxId: 467705]}
heltgqqlpefemvdqagyqkksaefynkpmlvvewaswcpdcqkqlpeiqkvyekykgk
ihfvmldmldskretkeradqyisekdytfpyyydtderaadilhvqsiptiylvdknqk
vkkvmtdfhdeaalekqlee

SCOPe Domain Coordinates for d5um7a_:

Click to download the PDB-style file with coordinates for d5um7a_.
(The format of our PDB-style files is described here.)

Timeline for d5um7a_:

  • d5um7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16