SCOPe 2.08: Domain d5um7a_: 5um7 A:

Lineage for d5um7a_ (5um7 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Streptococcus gordonii [TaxId:467705] [329931] (1 PDB entry)

8. Domain d5um7a_: 5um7 A: [329951]
   automated match to d2h1bc_
   complexed with act

Details for d5um7a_

PDB Entry: 5um7, 1.62 Å

PDB Description: crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii

PDB Compounds: (A:) Thioredoxin signature protein

SCOPe Domain Sequences for d5um7a_:

Sequence; same for both SEQRES and ATOM records:

>d5um7a_ c.47.1.0 (A:) automated matches {Streptococcus gordonii [TaxId: 467705]}
heltgqqlpefemvdqagyqkksaefynkpmlvvewaswcpdcqkqlpeiqkvyekykgk
ihfvmldmldskretkeradqyisekdytfpyyydtderaadilhvqsiptiylvdknqk
vkkvmtdfhdeaalekqlee

Timeline for d5um7a_:

• d5um7a_ first appeared in SCOPe 2.06
  
• d5um7a_ appears in SCOPe 2.07