SCOP 1.65: Domain d1f3aa2: 1f3a A:1-79

Lineage for d1f3aa2 (1f3a A:1-79)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [52872] (2 PDB entries)

8. Domain d1f3aa2: 1f3a A:1-79 [32995]
   Other proteins in same PDB: d1f3aa1, d1f3ab1

Details for d1f3aa2

PDB Entry: 1f3a, 1.9 Å

PDB Description: crystal structure of mgsta1-1 in complex with gsh

SCOP Domain Sequences for d1f3aa2:

Sequence; same for both SEQRES and ATOM records:

>d1f3aa2 c.47.1.5 (A:1-79) Class alpha GST {Mouse (Mus musculus), (a1-1)}
agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatkyd

Timeline for d1f3aa2:

• d1f3aa2 first appeared (with stable ids) in SCOP 1.55
  
• d1f3aa2 appears in SCOP 1.63
  
• d1f3aa2 appears in SCOP 1.67
  
• d1f3aa2 appears in the current release, SCOPe 2.08