Lineage for d1f3aa2 (1f3a A:1-79)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181191Species Mouse (Mus musculus), class alpha (a1-1) [TaxId:10090] [52872] (2 PDB entries)
  8. 181192Domain d1f3aa2: 1f3a A:1-79 [32995]
    Other proteins in same PDB: d1f3aa1, d1f3ab1

Details for d1f3aa2

PDB Entry: 1f3a (more details), 1.9 Å

PDB Description: crystal structure of mgsta1-1 in complex with gsh

SCOP Domain Sequences for d1f3aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3aa2 c.47.1.5 (A:1-79) Glutathione S-transferase {Mouse (Mus musculus), class alpha (a1-1)}
agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatkyd

SCOP Domain Coordinates for d1f3aa2:

Click to download the PDB-style file with coordinates for d1f3aa2.
(The format of our PDB-style files is described here.)

Timeline for d1f3aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3aa1