Lineage for d5mhro1 (5mhr O:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (566 PDB entries)
  8. 2286643Domain d5mhro1: 5mhr O:1-107 [329944]
    Other proteins in same PDB: d5mhrg2, d5mhrh2, d5mhro2, d5mhrq2
    automated match to d1a5fl1

Details for d5mhro1

PDB Entry: 5mhr (more details), 3 Å

PDB Description: t3d reovirus sigma1 complexed with 9bg5 fab fragments
PDB Compounds: (O:) 9BG5 Fab light chain,LOC100046793 protein,MAb 110 light chain

SCOPe Domain Sequences for d5mhro1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mhro1 b.1.1.0 (O:1-107) automated matches {Mus musculus [TaxId: 10090]}
eivltqspttmaaspgekiiitcsasssissnylhwyqqkpgcspklliyrtsklasgvp
arfsgsgsgtsysltigtmeaedvatyycqqgssiytfgggtkleik

SCOPe Domain Coordinates for d5mhro1:

Click to download the PDB-style file with coordinates for d5mhro1.
(The format of our PDB-style files is described here.)

Timeline for d5mhro1:

  • d5mhro1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16