SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5grlb_ (5grl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (16 species)
    not a true protein
  7. 2286420Species Homo sapiens [TaxId:9606] [329721] (5 PDB entries)
  8. 2286642Domain d5grlb_: 5grl B: [329943]
    automated match to d3blxc_
    complexed with adp, ict, mg

Details for d5grlb_

PDB Entry: 5grl (more details), 2.79 Å

PDB Description: crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+), isocitrate and adp
PDB Compounds: (B:) Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial

SCOPe Domain Sequences for d5grlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5grlb_ c.77.1.0 (B:) automated matches {Homo sapiens [TaxId: 9606]}
rhtvtmipgdgigpelmlhvksvfrhacvpvdfeevhvssnadeedirnaimairrnrva
lkgnietnhnlppshksrnnilrtsldlyanvihckslpgvvtrhkdidilivrentege
ysslehesvagvveslkiitkakslriaeyafklaqesgrkkvtavhkanimklgdglfl
qccrevaarypqitfenmivdnttmqlvsrpqqfdvmvmpnlygnivnnvcaglvggpgl
vaganyghvyavfetatrntgksianknianptatllascmmldhlklhsyatsirkavl
asmdnenmhtpdiggqgttseaiqdvirhirving

SCOPe Domain Coordinates for d5grlb_:

Click to download the PDB-style file with coordinates for d5grlb_.
(The format of our PDB-style files is described here.)

Timeline for d5grlb_:

  • d5grlb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16