SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uq4b1 (5uq4 B:1-100)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173213Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2173214Protein automated matches [190081] (25 species)
    not a true protein
  7. 2286608Species Mycobacterium tuberculosis [TaxId:83332] [329909] (1 PDB entry)
  8. 2286635Domain d5uq4b1: 5uq4 B:1-100 [329936]
    Other proteins in same PDB: d5uq4b2
    automated match to d3hx9a_

Details for d5uq4b1

PDB Entry: 5uq4 (more details), 2.2 Å

PDB Description: crystal structure of heme-degrading protein rv3592 from mycobacterium tuberculosis - heme free with cleaved protein
PDB Compounds: (B:) monooxygenase

SCOPe Domain Sequences for d5uq4b1:

Sequence, based on SEQRES records: (download)

>d5uq4b1 d.58.4.0 (B:1-100) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
eafqawangpaiaahaghranpvatgasllefevvldvgg

Sequence, based on observed residues (ATOM records): (download)

>d5uq4b1 d.58.4.0 (B:1-100) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
eafqawangpaiagasllefevvldvgg

SCOPe Domain Coordinates for d5uq4b1:

Click to download the PDB-style file with coordinates for d5uq4b1.
(The format of our PDB-style files is described here.)

Timeline for d5uq4b1:

  • d5uq4b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5uq4b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5uq4a_