Lineage for d5uq4b1 (5uq4 B:1-100)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173213Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2173214Protein automated matches [190081] (27 species)
    not a true protein
  7. 2286608Species Mycobacterium tuberculosis [TaxId:83332] [329909] (1 PDB entry)
  8. 2286635Domain d5uq4b1: 5uq4 B:1-100 [329936]
    Other proteins in same PDB: d5uq4b2
    automated match to d3hx9a_

Details for d5uq4b1

PDB Entry: 5uq4 (more details), 2.2 Å

PDB Description: crystal structure of heme-degrading protein rv3592 from mycobacterium tuberculosis - heme free with cleaved protein
PDB Compounds: (B:) monooxygenase

SCOPe Domain Sequences for d5uq4b1:

Sequence, based on SEQRES records: (download)

>d5uq4b1 d.58.4.0 (B:1-100) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
eafqawangpaiaahaghranpvatgasllefevvldvgg

Sequence, based on observed residues (ATOM records): (download)

>d5uq4b1 d.58.4.0 (B:1-100) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
eafqawangpaiagasllefevvldvgg

SCOPe Domain Coordinates for d5uq4b1:

Click to download the PDB-style file with coordinates for d5uq4b1.
(The format of our PDB-style files is described here.)

Timeline for d5uq4b1:

  • d5uq4b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5uq4b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5uq4a_