Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
Domain d5u16a1: 5u16 A:1-178 [329933] Other proteins in same PDB: d5u16a2, d5u16a3, d5u16b_, d5u16c2, d5u16d_, d5u16e1, d5u16e2, d5u16f1, d5u16f2, d5u16g1, d5u16g2, d5u16h1, d5u16h2 automated match to d4l4va1 complexed with 7wo, cl, gol, na |
PDB Entry: 5u16 (more details), 2 Å
SCOPe Domain Sequences for d5u16a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u16a1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d5u16a1: