Lineage for d5u16a1 (5u16 A:1-178)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545737Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)
  8. 2545808Domain d5u16a1: 5u16 A:1-178 [329933]
    Other proteins in same PDB: d5u16a2, d5u16a3, d5u16b_, d5u16c2, d5u16d_, d5u16e1, d5u16e2, d5u16f1, d5u16f2, d5u16g1, d5u16g2, d5u16h1, d5u16h2
    automated match to d4l4va1
    complexed with 7wo, cl, gol, na

Details for d5u16a1

PDB Entry: 5u16 (more details), 2 Å

PDB Description: structure of human mr1-2-oh-1-na in complex with human mait a-f7 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u16a1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d5u16a1:

Click to download the PDB-style file with coordinates for d5u16a1.
(The format of our PDB-style files is described here.)

Timeline for d5u16a1: