SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5um7b_ (5um7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (160 species)
    not a true protein
  7. 2286630Species Streptococcus gordonii [TaxId:467705] [329931] (1 PDB entry)
  8. 2286631Domain d5um7b_: 5um7 B: [329932]
    automated match to d2h1bc_
    complexed with act

Details for d5um7b_

PDB Entry: 5um7 (more details), 1.62 Å

PDB Description: crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii
PDB Compounds: (B:) Thioredoxin signature protein

SCOPe Domain Sequences for d5um7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5um7b_ c.47.1.0 (B:) automated matches {Streptococcus gordonii [TaxId: 467705]}
eheltgqqlpefemvdqagyqkksaefynkpmlvvewaswcpdcqkqlpeiqkvyekykg
kihfvmldmldskretkeradqyisekdytfpyyydtderaadilhvqsiptiylvdknq
kvkkvmtdfhdeaalekqleei

SCOPe Domain Coordinates for d5um7b_:

Click to download the PDB-style file with coordinates for d5um7b_.
(The format of our PDB-style files is described here.)

Timeline for d5um7b_:

  • d5um7b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16