Lineage for d5umgb_ (5umg B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089772Protein automated matches [194480] (6 species)
    not a true protein
  7. 2286601Species Klebsiella pneumoniae [TaxId:272620] [329902] (1 PDB entry)
  8. 2286629Domain d5umgb_: 5umg B: [329930]
    automated match to d1aj2a_
    complexed with gol

Details for d5umgb_

PDB Entry: 5umg (more details), 2.6 Å

PDB Description: crystal structure of dihydropteroate synthase from klebsiella pneumoniae subsp.
PDB Compounds: (B:) dihydropteroate synthase

SCOPe Domain Sequences for d5umgb_:

Sequence, based on SEQRES records: (download)

>d5umgb_ c.1.21.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mklvaqgstldlshphvmgilnvtpdsfsdggahnslieavkhanlminagatiidigge
strpgaaevsveeelarvipvveaiaqrfevwisvdtskaevirqsaragahiindirsl
tepgalqaaaetglpvclmhmqgqpktmqeapkyedvfadverffnehivrceqagiake
kllldpgfgfgknlshnyqllarlgefhhfglpllvgmsrksmvgqllnvgpserlngsl
acaviaamqgaqiirvhdvketvealrvveatlaakgkkrye

Sequence, based on observed residues (ATOM records): (download)

>d5umgb_ c.1.21.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mklvaqgstldlshphvmgilnvthnslieavkhanlminagatiidiggeevsveeela
rvipvveaiaqrfevwisvdtskaevirqsaragahiindirsltepgalqaaaetglpv
clmhmqkyedvfadverffnehivrceqagiakekllldpgfgfgknlshnyqllarlge
fhhfglpllvgmsrksmvgqllnvgpserlngslacaviaamqgaqiirvhdvketveal
rvveatlaakgkkrye

SCOPe Domain Coordinates for d5umgb_:

Click to download the PDB-style file with coordinates for d5umgb_.
(The format of our PDB-style files is described here.)

Timeline for d5umgb_:

  • d5umgb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16