Lineage for d5jgna_ (5jgn A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2153717Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2154375Protein automated matches [193860] (2 species)
    not a true protein
  7. 2279693Species Enterobacteria phage [TaxId:348604] [322994] (7 PDB entries)
  8. 2286612Domain d5jgna_: 5jgn A: [329913]
    automated match to d212la_
    complexed with cl, k, po4, v1a

Details for d5jgna_

PDB Entry: 5jgn (more details), 1.53 Å

PDB Description: spin-labeled t4 lysozyme construct i9v1
PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d5jgna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jgna_ d.2.1.3 (A:) automated matches {Enterobacteria phage [TaxId: 348604]}
mnifemlrcdeglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d5jgna_:

Click to download the PDB-style file with coordinates for d5jgna_.
(The format of our PDB-style files is described here.)

Timeline for d5jgna_:

  • d5jgna_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16