SCOP 1.65: Domain d1ev9c2: 1ev9 C:2-79

Lineage for d1ev9c2 (1ev9 C:2-79)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Rat (Rattus norvegicus), (a1-1) [TaxId:10116] [52871] (2 PDB entries)

8. Domain d1ev9c2: 1ev9 C:2-79 [32991]
   Other proteins in same PDB: d1ev9a1, d1ev9c1, d1ev9d1

Details for d1ev9c2

PDB Entry: 1ev9, 2.2 Å

PDB Description: rat glutathione s-transferase a1-1 mutant w21f with gso3 bound

SCOP Domain Sequences for d1ev9c2:

Sequence; same for both SEQRES and ATOM records:

>d1ev9c2 c.47.1.5 (C:2-79) Class alpha GST {Rat (Rattus norvegicus), (a1-1)}
sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatky

Timeline for d1ev9c2:

• d1ev9c2 first appeared (with stable ids) in SCOP 1.55
  
• d1ev9c2 appears in SCOP 1.63
  
• d1ev9c2 appears in SCOP 1.67
  
• d1ev9c2 appears in the current release, SCOPe 2.08