Lineage for d5unla_ (5unl A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107269Species Burkholderia multivorans [TaxId:87883] [329907] (1 PDB entry)
  8. 2107270Domain d5unla_: 5unl A: [329908]
    automated match to d4rf5a_
    complexed with edo, no3

Details for d5unla_

PDB Entry: 5unl (more details), 1.65 Å

PDB Description: crystal structure of a d-beta-hydroxybutyrate dehydrogenase from burkholderia multivorans
PDB Compounds: (A:) 3-ketoacyl-ACP reductase

SCOPe Domain Sequences for d5unla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5unla_ c.2.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 87883]}
tasdllkpydglrvlvtggasgiglaiadafaecgarvhvcdasqaaiaaladrpsraai
gatladvsdraavervfadvaatlggldvlvnnagiagptggideidpaqweqtvainln
aqfefarravpllreskhggaiialssvagrlgyayrtpyaatkwavvglvkslaielgp
lgirvnaiqpgivrgprirrviearaqqlgigydemeqrylerislrrmtepaeiaatal
flcspgghgitgqaisvcgnvevl

SCOPe Domain Coordinates for d5unla_:

Click to download the PDB-style file with coordinates for d5unla_.
(The format of our PDB-style files is described here.)

Timeline for d5unla_: