SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5unla_ (5unl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2286606Species Burkholderia multivorans [TaxId:87883] [329907] (1 PDB entry)
  8. 2286607Domain d5unla_: 5unl A: [329908]
    automated match to d4rf5a_
    complexed with edo, no3

Details for d5unla_

PDB Entry: 5unl (more details), 1.65 Å

PDB Description: crystal structure of a d-beta-hydroxybutyrate dehydrogenase from burkholderia multivorans
PDB Compounds: (A:) 3-ketoacyl-ACP reductase

SCOPe Domain Sequences for d5unla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5unla_ c.2.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 87883]}
tasdllkpydglrvlvtggasgiglaiadafaecgarvhvcdasqaaiaaladrpsraai
gatladvsdraavervfadvaatlggldvlvnnagiagptggideidpaqweqtvainln
aqfefarravpllreskhggaiialssvagrlgyayrtpyaatkwavvglvkslaielgp
lgirvnaiqpgivrgprirrviearaqqlgigydemeqrylerislrrmtepaeiaatal
flcspgghgitgqaisvcgnvevl

SCOPe Domain Coordinates for d5unla_:

Click to download the PDB-style file with coordinates for d5unla_.
(The format of our PDB-style files is described here.)

Timeline for d5unla_:

  • d5unla_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16