SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5umhb_ (5umh B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035756Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2036175Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2036176Protein automated matches [227026] (4 species)
    not a true protein
  7. 2286603Species Burkholderia multivorans [TaxId:395019] [329904] (1 PDB entry)
  8. 2286604Domain d5umhb_: 5umh B: [329905]
    automated match to d1dmha_
    complexed with ca, cl, edo, pg4, pg6, zn

Details for d5umhb_

PDB Entry: 5umh (more details), 1.35 Å

PDB Description: crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
PDB Compounds: (B:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d5umhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5umhb_ b.3.6.0 (B:) automated matches {Burkholderia multivorans [TaxId: 395019]}
svkvfdtkevqdllkaaanlngdagnarfrqivhrllsdlfkaiddlditpdevwagvny
lnklgqdgeaallaagiglekyldirmdaadraagldggtprtiegplyvagapvrdgva
kidldddadagplvirgtvtgtdgkplagalvecwhanskgfyshfdptgaqtafnlrga
vrtdangkyefrtlmpvgygcppqgatqqllnglgrhgnrpahvhffvsgdghrklttqf
niegdpliwddfayatreeliphvvdktggaalgmksdaykeiefdivltplldgrdnqv
vhrprasada

SCOPe Domain Coordinates for d5umhb_:

Click to download the PDB-style file with coordinates for d5umhb_.
(The format of our PDB-style files is described here.)

Timeline for d5umhb_:

  • d5umhb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16