SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5umga_ (5umg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089772Protein automated matches [194480] (6 species)
    not a true protein
  7. 2286601Species Klebsiella pneumoniae [TaxId:272620] [329902] (1 PDB entry)
  8. 2286602Domain d5umga_: 5umg A: [329903]
    automated match to d1aj2a_
    complexed with gol

Details for d5umga_

PDB Entry: 5umg (more details), 2.6 Å

PDB Description: crystal structure of dihydropteroate synthase from klebsiella pneumoniae subsp.
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d5umga_:

Sequence, based on SEQRES records: (download)

>d5umga_ c.1.21.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mklvaqgstldlshphvmgilnvtpdsfsdggahnslieavkhanlminagatiidigge
strpgaaevsveeelarvipvveaiaqrfevwisvdtskaevirqsaragahiindirsl
tepgalqaaaetglpvclmhmqgqpktmqeapkyedvfadverffnehivrceqagiake
kllldpgfgfgknlshnyqllarlgefhhfglpllvgmsrksmvgqllnvgpserlngsl
acaviaamqgaqiirvhdvketvealrvveatlaakgkkrye

Sequence, based on observed residues (ATOM records): (download)

>d5umga_ c.1.21.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mklvaqgstldlshphvmgilnvslieavkhanlminagatiidiggeevsveeelarvi
pvveaiaqrfevwisvdtskaevirqsaragahiindirsltepgalqaaaetglpvclm
hmqgqppkyedvfadverffnehivrceqagiakekllldpgfgfgknlshnyqllarlg
efhhfglpllvgmsrksmvgqllnvgpserlngslacaviaamqgaqiirvhdvketvea
lrvveatlaakgkrye

SCOPe Domain Coordinates for d5umga_:

Click to download the PDB-style file with coordinates for d5umga_.
(The format of our PDB-style files is described here.)

Timeline for d5umga_:

  • d5umga_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16