SCOPe 2.06: Domain d5u16h1: 5u16 H:1-116

Lineage for d5u16h1 (5u16 H:1-116)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5u16h1: 5u16 H:1-116 [329897]
   Other proteins in same PDB: d5u16a1, d5u16a3, d5u16b_, d5u16c1, d5u16d_, d5u16e2, d5u16g2
   automated match to d2axha1
   complexed with 7wo, cl, gol, na

Details for d5u16h1

PDB Entry: 5u16, 2 Å

PDB Description: structure of human mr1-2-oh-1-na in complex with human mait a-f7 tcr

PDB Compounds: (H:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d5u16h1:

Sequence; same for both SEQRES and ATOM records:

>d5u16h1 b.1.1.0 (H:1-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgev
pngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d5u16h1:

• d5u16h1 is new in SCOPe 2.06-stable
  
• d5u16h1 appears in SCOPe 2.07
  
• d5u16h1 appears in the current release, SCOPe 2.08