SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mt0a1 (5mt0 A:16-243)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057491Protein automated matches [190044] (14 species)
    not a true protein
  7. 2057530Species Human (Homo sapiens) [TaxId:9606] [187233] (142 PDB entries)
  8. 2286588Domain d5mt0a1: 5mt0 A:16-243 [329889]
    Other proteins in same PDB: d5mt0a2
    automated match to d1op8a_
    complexed with qjs, so4

Details for d5mt0a1

PDB Entry: 5mt0 (more details), 1.29 Å

PDB Description: complement factor d in complex with a reversible indole carboxylic acid based inhibitor
PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d5mt0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mt0a1 b.47.1.2 (A:16-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d5mt0a1:

Click to download the PDB-style file with coordinates for d5mt0a1.
(The format of our PDB-style files is described here.)

Timeline for d5mt0a1:

  • d5mt0a1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5mt0a2