SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5um0b1 (5um0 B:1-227)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128215Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2128216Protein automated matches [196989] (9 species)
    not a true protein
  7. 2286583Species Neisseria gonorrhoeae [TaxId:521006] [329884] (1 PDB entry)
  8. 2286584Domain d5um0b1: 5um0 B:1-227 [329885]
    Other proteins in same PDB: d5um0a2, d5um0b2, d5um0c2, d5um0d2
    automated match to d3gp3a_
    complexed with tla

Details for d5um0b1

PDB Entry: 5um0 (more details), 1.85 Å

PDB Description: crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae
PDB Compounds: (B:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d5um0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5um0b1 c.60.1.0 (B:1-227) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
melvfirhgqsewnaknlftgwrdvklseqglaeaaaagkklkengyefdiaftsvltra
iktcnivleesdqlfvpqiktwrlnerhygrlqgldkkqtaekygdeqvriwrrsydtlp
plldkddafsahkdrryahlpadvvpdgenlkvtlervlpfwedqiapailsgkrvlvaa
hgnslralakhiegisdedimgleiptgqplvyklddnlkviekfyl

SCOPe Domain Coordinates for d5um0b1:

Click to download the PDB-style file with coordinates for d5um0b1.
(The format of our PDB-style files is described here.)

Timeline for d5um0b1:

  • d5um0b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16