SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uofa1 (5uof A:9-478)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (23 species)
    not a true protein
  7. 2286577Species Burkholderia multivorans [TaxId:395019] [329878] (1 PDB entry)
  8. 2286578Domain d5uofa1: 5uof A:9-478 [329879]
    Other proteins in same PDB: d5uofa2
    automated match to d5hxaa_
    complexed with edo, na, ser

Details for d5uofa1

PDB Entry: 5uof (more details), 1.7 Å

PDB Description: crystal structure of alpha,alpha-trehalose 6-phosphate sythase from burkholderia multivorans
PDB Compounds: (A:) Alpha,alpha-trehalose-phosphate synthase (UDP-forming)

SCOPe Domain Sequences for d5uofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uofa1 c.87.1.0 (A:9-478) automated matches {Burkholderia multivorans [TaxId: 395019]}
msrlivvsnrvaigedtrpsagglavgvmdalqetggvwfgwngeivgtpdaapairrdg
nvtyatvgltrrdydqyyrgfsnatlwpvfhyrgdlarfdrqeyagylrvnamlakqlaa
llrpddliwvhdyhllpfahalrelgvknpigfflhipfpspdvlrlvpphdelvkfmca
ydvtgfqtdadrqaftdyierrgigtasedgmlhahgrvvkvaaypigvypdaiaqaavq
ygarkpvkmlrdalggrklvmsvdrldyskglverfqafermlanapgwqgrvslvqiap
ptrsdvqtyqriretlegeagringrfsqldwtpiqylnrkyernllmaffrmsqvgyvt
plrdgmnlvakeyvasqdpadpgvlvlsefagaaaeltgallvnpydlsqmadalerals
mplaerqarheenlarlrandlsvwrdtfvadlrsvaaaasvtqragrri

SCOPe Domain Coordinates for d5uofa1:

Click to download the PDB-style file with coordinates for d5uofa1.
(The format of our PDB-style files is described here.)

Timeline for d5uofa1:

  • d5uofa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5uofa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5uofb_