Lineage for d5t79a_ (5t79 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081476Species Salmonella enterica [TaxId:99287] [225546] (2 PDB entries)
  8. 2286573Domain d5t79a_: 5t79 A: [329874]
    automated match to d3erpa_
    complexed with cl, ndp, so4

Details for d5t79a_

PDB Entry: 5t79 (more details), 1.86 Å

PDB Description: x-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol
PDB Compounds: (A:) Aldo-keto Reductase, OXIDOREDUCTASE

SCOPe Domain Sequences for d5t79a_:

Sequence, based on SEQRES records: (download)

>d5t79a_ c.1.7.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
miyqpdenryhtmeyrrcgrsgvklpaislglwhnfgdttrvensrallqrafdlgithf
dlannygpppgsaecnfgrilqedflpwrdeliistkagytmwdgpygdwgsrkyliasl
dqslkrmgleyvdifyhhrpdpetplketmkaldhlvrhgkalyvgisnypadlarqaid
iledlgtpclihqpkyslferwvedgllallqekgvgsiafsplaggqltdrylngiped
sraasgsrflkpeqitadklekvrrlnelaarrgqklsqmalawvlrndnvtsvligask
psqiedavgmlanrrfsaaecaeidaileg

Sequence, based on observed residues (ATOM records): (download)

>d5t79a_ c.1.7.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
miyqpdenryhtmeyrrcgrsgvklpaislglwhnfgdttrvensrallqrafdlgithf
dlannygpppgsaecnfgrilqedflpwrdeliistkagytmwdgpygdwgsrkyliasl
dqslkrmgleyvdifyhhrpdpetplketmkaldhlvrhgkalyvgisnypadlarqaid
iledlgtpclihqpkyslferwvedgllallqekgvgsiafsplaggqltdryllkpeqi
tadklekvrrlnelaarrgqklsqmalawvlrndnvtsvligaskpsqiedavgmlanrr
fsaaecaeidaileg

SCOPe Domain Coordinates for d5t79a_:

Click to download the PDB-style file with coordinates for d5t79a_.
(The format of our PDB-style files is described here.)

Timeline for d5t79a_:

  • d5t79a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16