SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t79a_ (5t79 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081476Species Salmonella enterica [TaxId:99287] [225546] (2 PDB entries)
  8. 2286573Domain d5t79a_: 5t79 A: [329874]
    automated match to d3erpa_
    complexed with cl, ndp, so4

Details for d5t79a_

PDB Entry: 5t79 (more details), 1.86 Å

PDB Description: x-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol
PDB Compounds: (A:) Aldo-keto Reductase, OXIDOREDUCTASE

SCOPe Domain Sequences for d5t79a_:

Sequence, based on SEQRES records: (download)

>d5t79a_ c.1.7.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
miyqpdenryhtmeyrrcgrsgvklpaislglwhnfgdttrvensrallqrafdlgithf
dlannygpppgsaecnfgrilqedflpwrdeliistkagytmwdgpygdwgsrkyliasl
dqslkrmgleyvdifyhhrpdpetplketmkaldhlvrhgkalyvgisnypadlarqaid
iledlgtpclihqpkyslferwvedgllallqekgvgsiafsplaggqltdrylngiped
sraasgsrflkpeqitadklekvrrlnelaarrgqklsqmalawvlrndnvtsvligask
psqiedavgmlanrrfsaaecaeidaileg

Sequence, based on observed residues (ATOM records): (download)

>d5t79a_ c.1.7.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
miyqpdenryhtmeyrrcgrsgvklpaislglwhnfgdttrvensrallqrafdlgithf
dlannygpppgsaecnfgrilqedflpwrdeliistkagytmwdgpygdwgsrkyliasl
dqslkrmgleyvdifyhhrpdpetplketmkaldhlvrhgkalyvgisnypadlarqaid
iledlgtpclihqpkyslferwvedgllallqekgvgsiafsplaggqltdryllkpeqi
tadklekvrrlnelaarrgqklsqmalawvlrndnvtsvligaskpsqiedavgmlanrr
fsaaecaeidaileg

SCOPe Domain Coordinates for d5t79a_:

Click to download the PDB-style file with coordinates for d5t79a_.
(The format of our PDB-style files is described here.)

Timeline for d5t79a_:

  • d5t79a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16