SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gt0d_ (5gt0 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986958Protein automated matches [193445] (6 species)
    not a true protein
  7. 1986993Species Human (Homo sapiens) [TaxId:9606] [193446] (46 PDB entries)
  8. 2286572Domain d5gt0d_: 5gt0 D: [329873]
    Other proteins in same PDB: d5gt0b_, d5gt0f_
    automated match to d3afad_
    protein/DNA complex; complexed with cl, mn

Details for d5gt0d_

PDB Entry: 5gt0 (more details), 2.82 Å

PDB Description: crystal structure of nucleosome complex with human testis-specific histone variants, th2a
PDB Compounds: (D:) Histone H2B type 1-J

SCOPe Domain Sequences for d5gt0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gt0d_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krkrsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrs
titsreiqtavrlllpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d5gt0d_:

Click to download the PDB-style file with coordinates for d5gt0d_.
(The format of our PDB-style files is described here.)

Timeline for d5gt0d_:

  • d5gt0d_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16