SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tg3c_ (5tg3 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (24 species)
    not a true protein
  7. 2286568Species Dioclea reflexa [TaxId:1048258] [329869] (1 PDB entry)
  8. 2286569Domain d5tg3c_: 5tg3 C: [329870]
    automated match to d4nota_
    complexed with ca, mn, xmm

Details for d5tg3c_

PDB Entry: 5tg3 (more details), 1.77 Å

PDB Description: crystal structure of dioclea reflexa seed lectin (drfl) in complex with x-man
PDB Compounds: (C:) Dioclea reflexa lectin

SCOPe Domain Sequences for d5tg3c_:

Sequence, based on SEQRES records: (download)

>d5tg3c_ b.29.1.1 (C:) automated matches {Dioclea reflexa [TaxId: 1048258]}
adtivaveldsypntdigdpnyphigidiksvrskstarwnmqtgkvgtvhisynsvskr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglykqtntilswsftsklktnsi
adenslhfsfhkfsqnpkdlilqgdastdsdgnlqltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdttipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d5tg3c_ b.29.1.1 (C:) automated matches {Dioclea reflexa [TaxId: 1048258]}
adtivaveldsypntdigdpnyphigidiksvrskstarwnmqtgkvgtvhisynsvskr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglykqtntilswsftsklknslh
fsfhkfsqnpkdlilqgdastdsdgnlqltkvsssgdpqgnsvgralfyapvhiweksav
vasfdatftflikspdrepadgitffiantdttipsgsggrllglfpdan

SCOPe Domain Coordinates for d5tg3c_:

Click to download the PDB-style file with coordinates for d5tg3c_.
(The format of our PDB-style files is described here.)

Timeline for d5tg3c_:

  • d5tg3c_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16