Lineage for d5fv4d_ (5fv4 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134301Protein automated matches [190065] (6 species)
    not a true protein
  7. 2286403Species Sus scrofa [TaxId:9823] [329704] (1 PDB entry)
  8. 2286563Domain d5fv4d_: 5fv4 D: [329864]
    automated match to d1k4ya_

Details for d5fv4d_

PDB Entry: 5fv4 (more details), 2.4 Å

PDB Description: pig liver esterase 5 (ple5)
PDB Compounds: (D:) Carboxylic ester hydrolase

SCOPe Domain Sequences for d5fv4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fv4d_ c.69.1.1 (D:) automated matches {Sus scrofa [TaxId: 9823]}
sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvkntt
syppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmvwihg
gglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaalhwv
qenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvrkdmk
aaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpflttv
vdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllw
ksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrdagap
tymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfwanf
arsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk

SCOPe Domain Coordinates for d5fv4d_:

Click to download the PDB-style file with coordinates for d5fv4d_.
(The format of our PDB-style files is described here.)

Timeline for d5fv4d_:

  • d5fv4d_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16