Lineage for d5ucab_ (5uca B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015324Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2015325Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2015566Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2015567Protein automated matches [190172] (9 species)
    not a true protein
  7. 2015573Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries)
  8. 2015589Domain d5ucab_: 5uca B: [329862]
    automated match to d2rgzb_
    complexed with dao

Details for d5ucab_

PDB Entry: 5uca (more details), 2.12 Å

PDB Description: crystal structure of human heme oxygenase-2 in complex with laurate
PDB Compounds: (B:) Heme oxygenase 2

SCOPe Domain Sequences for d5ucab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucab_ a.132.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
lnmktkeriveeankafeynmqifneldqa

SCOPe Domain Coordinates for d5ucab_:

Click to download the PDB-style file with coordinates for d5ucab_.
(The format of our PDB-style files is described here.)

Timeline for d5ucab_: