SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ucab_ (5uca B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011656Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2011657Protein automated matches [190172] (9 species)
    not a true protein
  7. 2011663Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries)
  8. 2286561Domain d5ucab_: 5uca B: [329862]
    automated match to d2rgzb_
    complexed with dao

Details for d5ucab_

PDB Entry: 5uca (more details), 2.12 Å

PDB Description: crystal structure of human heme oxygenase-2 in complex with laurate
PDB Compounds: (B:) Heme oxygenase 2

SCOPe Domain Sequences for d5ucab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucab_ a.132.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
lnmktkeriveeankafeynmqifneldqa

SCOPe Domain Coordinates for d5ucab_:

Click to download the PDB-style file with coordinates for d5ucab_.
(The format of our PDB-style files is described here.)

Timeline for d5ucab_:

  • d5ucab_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16