Class a: All alpha proteins [46456] (290 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
Protein automated matches [190172] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries) |
Domain d5ucab_: 5uca B: [329862] automated match to d2rgzb_ complexed with dao |
PDB Entry: 5uca (more details), 2.12 Å
SCOPe Domain Sequences for d5ucab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ucab_ a.132.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald lnmktkeriveeankafeynmqifneldqa
Timeline for d5ucab_: