Lineage for d1agsb2 (1ags B:1-79)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24252Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)
  8. 24278Domain d1agsb2: 1ags B:1-79 [32986]
    Other proteins in same PDB: d1agsa1, d1agsb1

Details for d1agsb2

PDB Entry: 1ags (more details), 2.5 Å

PDB Description: a surface mutant (g82r) of a human alpha-glutathione s-transferase shows decreased thermal stability and a new mode of molecular association in the crystal

SCOP Domain Sequences for d1agsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agsb2 c.47.1.5 (B:1-79) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOP Domain Coordinates for d1agsb2:

Click to download the PDB-style file with coordinates for d1agsb2.
(The format of our PDB-style files is described here.)

Timeline for d1agsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agsb1