Lineage for d5jgua_ (5jgu A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2153717Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2153723Protein Phage T4 lysozyme [53982] (1 species)
  7. 2153724Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2286557Domain d5jgua_: 5jgu A: [329858]
    automated match to d3l2xa_
    complexed with cl, k, po4, v1a

Details for d5jgua_

PDB Entry: 5jgu (more details), 1.47 Å

PDB Description: spin-labeled t4 lysozyme construct r119v1
PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d5jgua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jgua_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslcm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d5jgua_:

Click to download the PDB-style file with coordinates for d5jgua_.
(The format of our PDB-style files is described here.)

Timeline for d5jgua_:

  • d5jgua_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16