SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tqca_ (5tqc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2006457Species Human (Homo sapiens) [TaxId:9606] [187211] (11 PDB entries)
  8. 2286555Domain d5tqca_: 5tqc A: [329856]
    automated match to d1qbkb_

Details for d5tqca_

PDB Entry: 5tqc (more details), 3 Å

PDB Description: crystal structure of transport factor karyopherin-beta 2 in complex with the py-nls of ribosomal protein l4 (rpl4)
PDB Compounds: (A:) Transportin-1,Transportin-1

SCOPe Domain Sequences for d5tqca_:

Sequence, based on SEQRES records: (download)

>d5tqca_ a.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklksedep
trslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiaskgel
qnwpdllpklcslldsedyntcegafgalqkicedsaeildsdvldrplnimipkflqff
khsspkirshavacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcralvmll
evrmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklipv
lvngmkysdidiillkgdveedetipdseqdiggsggsgddtisdwnlrkcsaaaldvla
nvyrdellphilpllkellfhhewvvkesgilvlgaiaegcmqgmipylpeliphliqcl
sdkkalvrsitcwtlsryahwvvsqppdtylkplmtellkrildsnkrvqeaacsafatl
eeeactelvpylayildtlvfafskyqhknllilydaigtladsvghhlnkpeyiqmlmp
pliqkwnmlkdedkdlfplleclssvatalqsgflpycepvyqrcvnlvqktlaqamlnn
aqpdqyeapdkdfmivaldllsglaeglggnieqlvarsniltlmyqcmqdkmpevrqss
fallgdltkacfqhvkpciadfmpilgtnlnpefisvcnnatwaigeisiqmgiemqpyi
pmvlhqlveiinrpntpktllentaitigrlgyvcpqevapmlqqfirpwctslrnirdn
eekdsafrgictmisvnpsgviqdfiffcdavaswinpkddlrdmfckilhgfknqvgde
nwrrfsdqfplplkerlaafygv

Sequence, based on observed residues (ATOM records): (download)

>d5tqca_ a.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklksedep
trslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiaskgel
qnwpdllpklcslldsedyntcegafgalqkicedsaeildsdvldrplnimipkflqff
khsspkirshavacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcralvmll
evrmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklipv
lvngmkysdidiillkgdtisdwnlrkcsaaaldvlanvyrdellphilpllkellfhhe
wvvkesgilvlgaiaegcmqgmipylpeliphliqclsdkkalvrsitcwtlsryahwvv
sqppdtylkplmtellkrildsnkrvqeaacsafatleeeactelvpylayildtlvfaf
skyqhknllilydaigtladsvghhlnkpeyiqmlmppliqkwnmlkdedkdlfpllecl
ssvatalqsgflpycepvyqrcvnlvqktlaqamlnnaqpdqyeapdkdfmivaldllsg
laeglggnieqlvarsniltlmyqcmqdkmpevrqssfallgdltkacfqhvkpciadfm
pilgtnlnpefisvcnnatwaigeisiqmgiemqpyipmvlhqlveiinrpntpktllen
taitigrlgyvcpqevapmlqqfirpwctslrnirdneekdsafrgictmisvnpsgviq
dfiffcdavaswinpkddlrdmfckilhgfknqvgdenwrrfsdqfplplkerlaafygv

SCOPe Domain Coordinates for d5tqca_:

Click to download the PDB-style file with coordinates for d5tqca_.
(The format of our PDB-style files is described here.)

Timeline for d5tqca_:

  • d5tqca_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16