SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tn9b_ (5tn9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2286552Domain d5tn9b_: 5tn9 B: [329853]
    automated match to d3q95b_
    complexed with 7ec

Details for d5tn9b_

PDB Entry: 5tn9 (more details), 2.25 Å

PDB Description: crystal structure of the er-alpha ligand-binding domain (l372s,l536s) in complex with the obhs-bsc, 4-bromophenyl (1r,2r,4s)-5-(4- hydroxyphenyl)-6-(4-(2-(piperidin-1-yl)ethoxy)phenyl)-7- oxabicyclo[2.2.1]hept-5-ene-2-sulfonate
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d5tn9b_:

Sequence, based on SEQRES records: (download)

>d5tn9b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydllleml
da

Sequence, based on observed residues (ATOM records): (download)

>d5tn9b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltshd
qvhllecawleilmiglvwrsmehpgkllfapnllldrnqgmveifdmllatssrfrmmn
lqgeefvclksiillnsgveekdhihrvldkitdtlihlmakagltlqqqhqrlaqllli
lshirhmsnkgmehlysvvpsydlllemlda

SCOPe Domain Coordinates for d5tn9b_:

Click to download the PDB-style file with coordinates for d5tn9b_.
(The format of our PDB-style files is described here.)

Timeline for d5tn9b_:

  • d5tn9b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16