Lineage for d1agsa2 (1ags A:1-79)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181030Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)
  8. 181055Domain d1agsa2: 1ags A:1-79 [32985]
    Other proteins in same PDB: d1agsa1, d1agsb1

Details for d1agsa2

PDB Entry: 1ags (more details), 2.5 Å

PDB Description: a surface mutant (g82r) of a human alpha-glutathione s-transferase shows decreased thermal stability and a new mode of molecular association in the crystal

SCOP Domain Sequences for d1agsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agsa2 c.47.1.5 (A:1-79) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOP Domain Coordinates for d1agsa2:

Click to download the PDB-style file with coordinates for d1agsa2.
(The format of our PDB-style files is described here.)

Timeline for d1agsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agsa1