SCOPe 2.06: Domain d5u16c1: 5u16 C:1-178

Lineage for d5u16c1 (5u16 C:1-178)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d5u16c1: 5u16 C:1-178 [329847]
   Other proteins in same PDB: d5u16a2, d5u16a3, d5u16b_, d5u16c2, d5u16d_, d5u16e1, d5u16e2, d5u16f1, d5u16f2, d5u16g1, d5u16g2, d5u16h1, d5u16h2
   automated match to d4l4va1
   complexed with 7wo, cl, gol, na

Details for d5u16c1

PDB Entry: 5u16, 2 Å

PDB Description: structure of human mr1-2-oh-1-na in complex with human mait a-f7 tcr

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u16c1:

Sequence; same for both SEQRES and ATOM records:

>d5u16c1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d5u16c1:

• d5u16c1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16
  
• d5u16c1 appears in the current release, SCOPe 2.07