SCOPe 2.08: Domain d5jjfa_: 5jjf A:

Lineage for d5jjfa_ (5jjf A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein Sensory rhodopsin II [64526] (1 species)

7. Species Natronobacterium pharaonis [TaxId:2257] [64527] (14 PDB entries)

8. Domain d5jjfa_: 5jjf A: [329846]
   Other proteins in same PDB: d5jjfb_
   automated match to d1h2sa_
   complexed with bog, lfa, ret

Details for d5jjfa_

PDB Entry: 5jjf, 1.9 Å

PDB Description: structure of the srii/htrii complex in i212121 space group ("u" shape) - m state

PDB Compounds: (A:) Sensory rhodopsin-2

SCOPe Domain Sequences for d5jjfa_:

Sequence; same for both SEQRES and ATOM records:

>d5jjfa_ f.13.1.1 (A:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
vglttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwv
pvaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgi
eryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllg
ppgvalltptvdvalivyldlvtkvgfgfialdaaatlrae

Timeline for d5jjfa_:

• d5jjfa_ first appeared in SCOPe 2.06
  
• d5jjfa_ appears in SCOPe 2.07