Lineage for d5jjfa_ (5jjf A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576670Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2576671Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2576672Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 protein domains)
  6. 2576814Protein Sensory rhodopsin II [64526] (1 species)
  7. 2576815Species Natronobacterium pharaonis [TaxId:2257] [64527] (14 PDB entries)
  8. 2576822Domain d5jjfa_: 5jjf A: [329846]
    Other proteins in same PDB: d5jjfb_
    automated match to d1h2sa_
    complexed with bog, lfa, ret

Details for d5jjfa_

PDB Entry: 5jjf (more details), 1.9 Å

PDB Description: structure of the srii/htrii complex in i212121 space group ("u" shape) - m state
PDB Compounds: (A:) Sensory rhodopsin-2

SCOPe Domain Sequences for d5jjfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjfa_ f.13.1.1 (A:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
vglttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwv
pvaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgi
eryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllg
ppgvalltptvdvalivyldlvtkvgfgfialdaaatlrae

SCOPe Domain Coordinates for d5jjfa_:

Click to download the PDB-style file with coordinates for d5jjfa_.
(The format of our PDB-style files is described here.)

Timeline for d5jjfa_: