SCOP 1.61: Domain d1gumh2: 1gum H:4-80

Lineage for d1gumh2 (1gum H:4-80)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)

8. Domain d1gumh2: 1gum H:4-80 [32984]
   Other proteins in same PDB: d1guma1, d1gumb1, d1gumc1, d1gumd1, d1gume1, d1gumf1, d1gumg1, d1gumh1

Details for d1gumh2

PDB Entry: 1gum, 3 Å

PDB Description: human glutathione transferase a4-4 without ligands

SCOP Domain Sequences for d1gumh2:

Sequence; same for both SEQRES and ATOM records:

>d1gumh2 c.47.1.5 (H:4-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

Timeline for d1gumh2:

• d1gumh2 first appeared (with stable ids) in SCOP 1.55
  
• d1gumh2 appears in SCOP 1.59
  
• d1gumh2 appears in SCOP 1.63
  
• d1gumh2 appears in the current release, SCOPe 2.08