SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jjea_ (5jje A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225116Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 protein domains)
  6. 2225215Protein Sensory rhodopsin II [64526] (1 species)
  7. 2225216Species Natronobacterium pharaonis [TaxId:2257] [64527] (14 PDB entries)
  8. 2286536Domain d5jjea_: 5jje A: [329837]
    Other proteins in same PDB: d5jjeb_
    automated match to d1h2sa_
    complexed with bog, lfa, ret

Details for d5jjea_

PDB Entry: 5jje (more details), 1.9 Å

PDB Description: structure of the srii/htrii complex in i212121 space group ("u" shape)
PDB Compounds: (A:) Sensory rhodopsin-2

SCOPe Domain Sequences for d5jjea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjea_ f.13.1.1 (A:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
vglttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwv
pvaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgi
eryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllg
ppgvalltptvdvalivyldlvtkvgfgfialdaaatlrae

SCOPe Domain Coordinates for d5jjea_:

Click to download the PDB-style file with coordinates for d5jjea_.
(The format of our PDB-style files is described here.)

Timeline for d5jjea_:

  • d5jjea_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16