Lineage for d5t2va_ (5t2v A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (233 species)
    not a true protein
  7. 2095426Species Mycobacterium smegmatis [TaxId:246196] [189539] (6 PDB entries)
  8. 2286532Domain d5t2va_: 5t2v A: [329833]
    automated match to d3tzhc_
    complexed with mg

Details for d5t2va_

PDB Entry: 5t2v (more details), 1.9 Å

PDB Description: crystal structure of msmeg_6753 a putative betaketoacyl-acp reductase
PDB Compounds: (A:) Oxidoreductase, short chain dehydrogenase/reductase family protein

SCOPe Domain Sequences for d5t2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2va_ c.2.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
elegltalvtggtsgiglesarlmaaegadvvitgrdaqrgeqaaadighgarfvqadlg
dldsvadlaaqapdvdilvnnagiypqastfdqdvagfqqlfdtnvrgtyflvaaaakgm
varghgsivnittlaahkgfpgtsvygatkaalesltrtwaaefgangvrvnsvspgptr
tpttleqlgdfiddvaaglplrrtaapeeiaqavlflasprasfvtgstlyvdgggyav

SCOPe Domain Coordinates for d5t2va_:

Click to download the PDB-style file with coordinates for d5t2va_.
(The format of our PDB-style files is described here.)

Timeline for d5t2va_:

  • d5t2va_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16