SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t2va_ (5t2v A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2095426Species Mycobacterium smegmatis [TaxId:246196] [189539] (6 PDB entries)
  8. 2286532Domain d5t2va_: 5t2v A: [329833]
    automated match to d3tzhc_
    complexed with mg

Details for d5t2va_

PDB Entry: 5t2v (more details), 1.9 Å

PDB Description: crystal structure of msmeg_6753 a putative betaketoacyl-acp reductase
PDB Compounds: (A:) Oxidoreductase, short chain dehydrogenase/reductase family protein

SCOPe Domain Sequences for d5t2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2va_ c.2.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
elegltalvtggtsgiglesarlmaaegadvvitgrdaqrgeqaaadighgarfvqadlg
dldsvadlaaqapdvdilvnnagiypqastfdqdvagfqqlfdtnvrgtyflvaaaakgm
varghgsivnittlaahkgfpgtsvygatkaalesltrtwaaefgangvrvnsvspgptr
tpttleqlgdfiddvaaglplrrtaapeeiaqavlflasprasfvtgstlyvdgggyav

SCOPe Domain Coordinates for d5t2va_:

Click to download the PDB-style file with coordinates for d5t2va_.
(The format of our PDB-style files is described here.)

Timeline for d5t2va_:

  • d5t2va_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16