SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mmua_ (5mmu A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192501Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2192753Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2192754Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 protein domains)
  6. 2192817Protein automated matches [190058] (6 species)
    not a true protein
  7. 2286530Species Malus domestica [TaxId:3750] [329831] (1 PDB entry)
  8. 2286531Domain d5mmua_: 5mmu A: [329832]
    automated match to d1e09a_

Details for d5mmua_

PDB Entry: 5mmu (more details)

PDB Description: nmr solution structure of the major apple allergen mal d 1
PDB Compounds: (A:) Major allergen Mal d 1

SCOPe Domain Sequences for d5mmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmua_ d.129.3.1 (A:) automated matches {Malus domestica [TaxId: 3750]}
gvytfeneftseippsrlfkafvldadnlipkiapqaikqaeilegnggpgtikkitfge
gsqygyvkhridsideasysysytliegdaltdtiekisyetklvacgsgstiksishyh
tkgnieikeehvkvgkekahglfkliesylkdhpdayn

SCOPe Domain Coordinates for d5mmua_:

Click to download the PDB-style file with coordinates for d5mmua_.
(The format of our PDB-style files is described here.)

Timeline for d5mmua_:

  • d5mmua_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15