SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5inub2 (5inu B:277-460)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107283Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 protein domains)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2107284Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)
  7. 2107285Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (8 PDB entries)
    Uniprot P07342 84-687
  8. 2286526Domain d5inub2: 5inu B:277-460 [329827]
    Other proteins in same PDB: d5inua1, d5inub1
    automated match to d1n0ha1
    complexed with fad, k, mg, oxy, po4, pyr, tpp

Details for d5inub2

PDB Entry: 5inu (more details), 1.98 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase
PDB Compounds: (B:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5inub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5inub2 c.31.1.3 (B:277-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlq
glgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraa
aegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkk
eypy

SCOPe Domain Coordinates for d5inub2:

Click to download the PDB-style file with coordinates for d5inub2.
(The format of our PDB-style files is described here.)

Timeline for d5inub2:

  • d5inub2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5inub1