SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jjeb_ (5jje B:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225606Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2225810Superfamily f.17.4: Htr2 transmembrane domain-like [158212] (1 family) (S)
  5. 2225811Family f.17.4.1: Htr2 transmembrane domain-like [158213] (1 protein)
  6. 2225812Protein Sensory rhodopsin II transducer, Htr2 [158214] (1 species)
  7. 2225813Species Natronomonas pharaonis [TaxId:2257] [158215] (5 PDB entries)
    Uniprot P42259 27-79! Uniprot P42259 29-79
  8. 2286525Domain d5jjeb_: 5jje B: [329826]
    Other proteins in same PDB: d5jjea_
    automated match to d2f95b1
    complexed with bog, lfa, ret

Details for d5jjeb_

PDB Entry: 5jje (more details), 1.9 Å

PDB Description: structure of the srii/htrii complex in i212121 space group ("u" shape)
PDB Compounds: (B:) sensory rhodopsin II transducer

SCOPe Domain Sequences for d5jjeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjeb_ f.17.4.1 (B:) Sensory rhodopsin II transducer, Htr2 {Natronomonas pharaonis [TaxId: 2257]}
mgavfifvgaltvlfgaiaygevtaaaatgdaaavqeaavsailgliillginlglvaat
lgg

SCOPe Domain Coordinates for d5jjeb_:

Click to download the PDB-style file with coordinates for d5jjeb_.
(The format of our PDB-style files is described here.)

Timeline for d5jjeb_:

  • d5jjeb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15