SCOPe 2.06: Domain d5jjnc_: 5jjn C:

Lineage for d5jjnc_ (5jjn C:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein Sensory rhodopsin II [64526] (1 species)

7. Species Natronobacterium pharaonis [TaxId:2257] [64527] (14 PDB entries)

8. Domain d5jjnc_: 5jjn C: [329824]
   automated match to d1h2sa_
   complexed with bog, lfa, ret

Details for d5jjnc_

PDB Entry: 5jjn, 2.25 Å

PDB Description: structure of the srii/htrii(g83f) complex in p212121 space group ("v" shape)

PDB Compounds: (C:) Sensory rhodopsin-2

SCOPe Domain Sequences for d5jjnc_:

Sequence; same for both SEQRES and ATOM records:

>d5jjnc_ f.13.1.1 (C:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
glttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwvp
vaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgie
ryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllgp
pgvalltptvdvalivyldlvtkvgfgfialdaaa

Timeline for d5jjnc_:

• d5jjnc_ is new in SCOPe 2.06-stable
  
• d5jjnc_ appears in SCOPe 2.07
  
• d5jjnc_ appears in the current release, SCOPe 2.08